Kabar65News

Menembus Peradaban

Dasar Hukum dan Syarat Pemecatan Presiden

Oleh : Chandra Kirana

Buntutbatalnya Seminar berjudul ‘PERSOALAN PEMECATAN PRESIDEN DITENGAH PANDEMI DITINJAU DARI SISTEM KETATANEGARAAN” padaJum’at 29 Mei2020 olehkomunitasmahasiswa Constitutional Law Society (CLS) FakultasHukumUniversitasGadjahMada (FH UGM).

Berakibatkepadaaksi terror danintimidasiketerhadappanitiadannarasumberdiskusiolehoknum-oknum yang mencarikesempatansecaratidakbertanggungjawab),salahsatupelakuterorlewat HP tersebutbahkanmencatutnamapengurusMuhammadiyahKlaten.NamunSekretarisUmum PP MuhammadiyahAbdul Mutisecarategasmengatakanpelakubukanpenggurus PP Muhammadiyah.

Dalamtulisansayapadatanggal 29 Mei 2020 di media online kabar65news.com denganjudul

“Ada DugaanMengepulkanNarasi Asap MakarMelalui Seminar”Bilahanyamelihatdarisisietikadengankondisimemangtidakpatut,namundarisisicivitasdiskusiintelektualakademismerupakanhal yang wajardalamruanglingkupakademisigunamengasahdayaanalisahdikalanganmahasiswafakultashukum,dantidakmenjadipersoalanpadaimplementasihukumatauyang mengarahpadapelanggaranpidana. Yang menjadipersoalannyajusterupihak-pihakpenyebarberitasecarababibuta yang diselipkandenganbumbusertakebohongan yang menyebabkankeresahandimasyarakat,sertamelakukanpengancamanterhadappenitiadannarasumberdiskusi.

Para penyebarkebohongan yang menimbulkankeresahankarenapenyebaranberita yang ditambah-tambahkandengankebohongansehinggamenciptakankeresahandimasyarakat yang disertaiancamanmakasesuaiketentuanPasal 28danpasal 29jo 45b UU no.19 tahun 2016 tentangInformasidanTransaksiElektronik/ITE,yaitu:

Pasal 28

Setiap Orang yang dengansengajadantanpahakmenyebarkanberitabohongdanmenyesatkan yang mengakibatkankerugiankonsumendalamTransaksiElektroniksebagaimanadimaksuddalamPasal 28 ayat (1) dipidanadenganpidanapenjara paling lama 6 (enam) tahundan/ataudenda paling banyakRp 1 miliar.

Pasal 29 UU ITE

Setiap orang dengansengajadantanpahakmengirimkanInformasielektronikdan/atauDokumenElektronik yang berisiancamankekerasanataumenakut-nakuti yang ditujukansecarapribadi.

Pasal 45B UU ITE

Setiap Orang yang dengansengajadantanpahakmengirimkanInformasiElektronikdan/atauDokumenElektronik yang berisiancamankekerasanataumenakut-nakuti yang ditujukansecarapribadisebagaimanadimaksuddalamPasal 29 dipidanadenganpidanapenjara paling lama 4 (empat) tahundan/ataudenda paling banyak Rp750.000.000,00 (tujuhratus lima puluhjuta rupiah).

Sementaramengenaipengancaman yang dilakukanolehpelakujugadapatdijeratsangsipadapasal 368 KUHP,dengantuntutanmaksimal 9 bulanpenjara.

Persolantersebuttentunyamenjadipekerjaanpihakaparatuntukmenindaklanjutibilamana para korban yang merasadirugikandankeselamatannyaterancammelakukanpelaporanterhadapkepolisian.

DalamhalinicobakitamemahamilebihdalamtentangsyaratpemecatanataumemberhentikanseorangPresidensebagaimana yang telahdiaturoleh UUD 1945,bukanhanyamelaluiasumsidanpandanganpribadidalammenciptakannarasimelaluicara-caraprovokatif.

BerdasarkanPasal 7A, 7B, dan 24C ayat (2) Undang-UndangDasar 1945 (“UUD 1945”) pejabat yang dapat diberhentikan(-impeach)adalah:

a.    Presiden

b.    WakilPresiden

c.    PresidendanWakilPresiden

Ada duaalasanPresidendapat di berhentikandalammasajabatannya, yaitu:

1.    Melakukanpelanggaranhukumberupa:

a.  Penghianatanterhadapnegara;

b.    Korupsi;

c.    Penyuapan;

d.    Tindakpidanaberatlainnya; atau

e.    Perbuatantercela.

2.    Terbuktitidaklagimemenuhisyaratsebagaipresiden

Pasal 7A UUD 1945

“Presidendan/atauWakilPresidendapatdiberhentikandalammasajabatannyaolehMajelisPermusyawaratan Rakyat atasusulDewanPerwakilan Rakyat, baikapabilaterbuktitelahmelakukanpelanggaranhukumberupapengkhianatanterhadapnegara, korupsi, penyuapan, tindakpidanaberatlainnya, atauperbuatantercelamaupunapabilaterbuktitidaklagimemenuhisyaratsebagaiPresidendan/atauWakilPresiden.”

Pasal 7B UUD 1945

  • UsulpemberhentianPresidendan/atauWakilPresidendapatdiajukanolehDewanPerwakilan Rakyat kepadaMajelisPermusyawaratan Rakyat hanyadenganterlebihdahulumengajukanpermintaankepadaMahkamahKonstitusiuntukmemeriksa, mengadili, danmemutuspendapatDewanPerwakilan Rakyat bahwaPresidendan/atauWakilPresidentelahmelakukanpelanggaranhukumberupapengkhianatanterhadapnegara, korupsi, penyuapan, tindakpidanaberatlainnya, atauperbuatantercela; dan/ataupendapatbahwaPresidendan/atauWakilPresidentidaklagimemenuhisyaratsebagaiPresidendan/atauWakilPresiden.

Pasal 24c

  • MahkamahKonstitusiwajibmemberikanputusanataspendapatDewanPerwakilan Rakyat mengenaidugaanpelanggaranolehPresidendan/atauWakilPresidenmenurutUndang-UndangDasar.

Jadipemberhentian(impeach) terhadapsesorangPresidenatauwakilpresidenpunyadasarhukum,bukanberdasarkanketidaksukaansuatukelompokataupribadi,yanghanyaberdasarkansuatuasumsi yang diciptkanmelaluipemikiransecarafiksi(menduga-duga).

Bilamanaadapihak yang mendesakataumelakukanprovokasimemintaPresidenmundursecaraterbukamelalui media massa,tentuharusditindaklanjutiuntukmengusut motif danmaksuddaridesakanmundur yang dilakukandimediamassamaupun media sosial,dimanaapa yang disampaikanberpotensimenimbulkankericuhandankeresahandimasyarakat. Sebabseorangpresiden yang didesakmundurataudiberhentikanharusmemilikialasandandasarhukumsesuai UUD 1945,bukanhanyamelaluinarasiProvokatifdanketidaksenangansemata.

Demikianhalnyadengansebuahjudul seminar yang dikarenakanadanyanarasiPEMECATAN PRESIDENLantasdipaksakanuntukdipidanakan,yangmanatujuannyauntukmembenturkanaparatpenegakhukumdengankaumakademisikhususnyamahasiswa,haldemikianmerupakan agenda permainan yang sangatkotor(Politis).

Tentunyahalinibukankebetulan,dannarasimakar yang digorengdemikianrupapastiadaketerkaitandenganisu-isudesakan yang dimunculkanbelakanganini,sehinggaadaupayadalammengepulkannarasimakardalam seminar yang dibatalkantersebut.

Upaya yang terlihatsangatjelasdugaanuntukmembenturkanJokowi yang merupakan alumni UGM denganpihakUniversitaskhususnyapanitiapenyelenggaraseminar,untukmenciptakan Chaos gunamembangkitkanamarahMahasiswa,dimana UGM merupakansalahsatu barometer perguruantinggidiIndonesia. NamunDemikianaparatkepolisiantetapharusmemintaklarifikasikepadapihakpanitiatentangnarasijudulseminar,sekaligusmelakukanpengusutanterhadappelakupengancamansetelah seminar tersebutdibatal. 

AntaraMakardanpemecatanPresidenduahal yang berbedadalamsubtansinamunkeduanyamemilikisyaratdandasarhukum yang harusterpenuhi,bukanmemaksakankehendakkepentingan yang bertujuanuntukmembunuhaktivitasmimbarIntelektualdiskusiakademisi,melalui agenda politikkotordantidakbermoraldidalamsituasidankesulitan yang  dihadapinegeriini.***(r/k65news).

Penulis : Merupakan Mahasiswa Fakultas Hukum Universitas Djuanda Bogor

Editor    : Adjie Saputra

_______________

“MENGUTIP SEBAGIAN ATAU SELURUH ISI PORTAL INI HARUS MENDAPAT IZIN TERTULIS DARI REDAKSI, HAK CIPTA DILINDUNGI UNDANG-UNDANG”

Tinggalkan Balasan

Alamat email Anda tidak akan dipublikasikan. Ruas yang wajib ditandai *